Putative candidates were then assessed for the known features of a sortase substrate: a predicted N-terminal signal peptide sequence, and a cell wall sorting signal comprising of a potential transmembrane domain following the sortase recognition sequence, and at least two consecutive basic residues (arginine or lysine) at the C-terminus [31–33]. Eight proteins satisfied our definition of a sortase substrate in strain 630 (Table 1). The newly described C. difficile collagen binding protein A, CbpA, is the only

protein containing the proposed NVQTG motif [30]. The remaining proteins contained one of four observed variations of the (S/P)PXTG motif: SPKTG, PPKTG, and SPSTG and SPQTG. These predicted C. difficile sortase substrates are a diverse range of surface proteins that include putative cell wall hydrolases, putative adhesins, a collagen-binding protein, and a 5’ nucleotidase/phosphoesterase (Table 1). #PKA activator randurls[1|1|,|CHEM1|]# Transcriptional analysis performed by RT-PCR confirmed that all eight predicted substrate proteins are transcribed during growth in vitro (Additional file 1: Figure S1B-I). The eight predicted substrates are transcribed during all three growth phases examined, with the exception of CD630_25370 and Obeticholic purchase CD630_32460, which do not appear to be transcribed during stationary phase.

Four of these putative substrates are conserved across all five C. difficile lineages: CD630_01830, CD630_25370, CD630_27680, and CD630_28310. Table 1 Identification of putative C. difficile SrtB substrates in strain 630 Protein Function C-terminal sorting signal CD630_01830 Putative cell wall hydrolase MIHSPSTGKTVSVTSINSSYYTARFVTA KRIL CD630_03860 Putative cell surface protein, collagen binding protein PSDSPKTGDNTNLYGLLALLLTSGAGLAGIFFY KRRKMKKS CD630_25370 Putative membrane-associated 5′-nucleotidase/phosphoesterase KEKSPKTGDLGFSNSIIIFIVSSTLICLLNFNQKELKDKKSK Urease CD630_27680 Putative cell-wall hydrolase FIHSPQTGDVVKVTSMAPGTNYA RRLITATRVLQ CD630_28310 Putative adhesion, collagen binding protein PPVPPKTGDSTTIIGEILLVIGAIVGLIVL RRNKNTN CD630_31450 Collagen binding protein,

CbpA VGQNVQTGDQSNIMLDLALMFISLFFLI KNLTNKYLRRK CD630_32460 Putative surface protein IVKSPKTGDETQLMSYVFISVIAICGLAYQCKIKRN CD630_33920 Putative cell surface protein, collagen binding protein PSDSPKTGDSTNLMAFIVMLLVSGGGLAGTYLY KRRKMKKS Bold = predicted sortase recognition sequence. Bold and Italic = hydrophobic residues. Italics only = positively charged residues. Purified C. difficile SrtB cleaves (S/P)PXTG peptides To determine whether C. difficile SrtB cleaves putative substrates at the predicted motifs, FRET peptides were designed based on the variations observed in the predicted (S/P)PXTG motif (Table 2). Two residues upstream of the motif were included, and two glycine residues were incorporated downstream, as this has been previously shown to improve sortase cleavage efficiency in vitro [34].